Analysis of single MD
Job name: VGFR3_HUMAN_mut_vector
Downloading trajectory... Please wait.
Loading...
Flareplot frames range 1-1 / 50
Charts:
Heatmap of unfolding of substrate (chain E) during simulation.
Color denotes a probability of presence of a hydrogen bond in subsequent parts of the simulation.

H - α-Helix, G - 310-Helix, I - π-Helix, E - Strand, B - Bridge, C - Coil, T - Turn.
Job info
GS Mode: membrane
Peptide substrate: VGFR3_HUMAN
Trimmed sequence: ASVAVEGSEDKGSMEIVILVGTGVIAVFFWVLL
Substrate length [aa]: 33
Total length [ns]: 15
Membrane thickness [Å]: 31.0
SMD chain and residues: E 33
SMD velocity [m/s]: 0.1
SMD k [kcal/mol/Å2]: 1.0
SMD (x y z) [Å]: (-7.204 -2.366 -8.898)
Mutations: CL48R
Continue mode
Selected frame:
Please select a frame 1 to 50 which will be the entry point for new simulation.
